CLDND1 anticorps (Middle Region)

N° du produit ABIN634913

Détail du produit anti-CLDND1 anticorps

Antigène: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLDND1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin Domain Containing 1 antibody was raised against the middle region of CLDND1

Purification: Affinity purified

Immunogène: Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin Domain Containing 1 Blocking Peptide, catalog no. 33R-9186, is also available for use as a blocking control in assays to test for specificity of this Claudin Domain Containing 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLDND1

Antigène: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Autre désignation: Claudin Domain Containing 1 (CLDND1 Produits)

Synonymes: anticorps MGC53751, anticorps LOC100217896, anticorps 1110019C08Rik, anticorps AA407103, anticorps AI849195, anticorps AW489850, anticorps Cldnd1, anticorps C3orf4, anticorps GENX-3745, anticorps claudin domain containing 1 L homeolog, anticorps claudin domain containing 1, anticorps cldnd1.L, anticorps cldnd1, anticorps CLDND1, anticorps Cldnd1

Sujet: CLDND1 belongs to the PMP-22/EMP/MP20 family. The exact function of CLDND1 remains unknown.

Poids moléculaire: 28 kDa (MW of target protein)