Metaxin 1 anticorps (C-Term)

N° du produit ABIN634920

Détail du produit anti-Metaxin 1 anticorps

Antigène: Metaxin 1 (MTX1)

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Metaxin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Metaxin 1 antibody was raised against the C terminal of MTX1

Purification: Affinity purified

Immunogène: Metaxin 1 antibody was raised using the C terminal of MTX1 corresponding to a region with amino acids CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Metaxin 1 Blocking Peptide, catalog no. 33R-1748, is also available for use as a blocking control in assays to test for specificity of this Metaxin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Metaxin 1

Antigène: Metaxin 1 (MTX1)

Autre désignation: Metaxin 1 (MTX1 Produits)

Synonymes: anticorps MTX, anticorps MTXN, anticorps Gcap6, anticorps Mtx, anticorps mtx1, anticorps zgc:101675, anticorps Metaxin-1, anticorps metaxin 1, anticorps metaxin 1b, anticorps Metaxin 1, anticorps metaxin 1 S homeolog, anticorps metaxin 1 (predicted), anticorps metaxin-1, anticorps MTX1, anticorps Mtx1, anticorps mtx1b, anticorps mtx1.S, anticorps mtx1, anticorps SPAC589.04, anticorps LOC100587360

Sujet: MTX1 belongs to the metaxin family. It is involved in transport of proteins into the mitochondrion and essential for embryonic development.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport