FAM20C anticorps (C-Term)

N° du produit ABIN634926

Détail du produit anti-FAM20C anticorps

Antigène: FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM20C est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM20 C antibody was raised against the C terminal of FAM20

Purification: Affinity purified

Immunogène: FAM20 C antibody was raised using the C terminal of FAM20 corresponding to a region with amino acids NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM20C Blocking Peptide, catalog no. 33R-6677, is also available for use as a blocking control in assays to test for specificity of this FAM20C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM20C

Antigène: FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))

Autre désignation: FAM20C (FAM20C Produits)

Synonymes: anticorps DMP-4, anticorps DMP4, anticorps GEF-CK, anticorps RNS, anticorps C76981, anticorps mKIAA4081, anticorps RGD1311980, anticorps si:ch73-266a4.1, anticorps FAM20C, golgi associated secretory pathway kinase, anticorps family with sequence similarity 20, member C, anticorps family with sequence similarity 20, member Cb, anticorps FAM20C, anticorps Fam20c, anticorps fam20cb

Sujet: FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.

Poids moléculaire: 66 kDa (MW of target protein)