Patched 1 anticorps
-
- Antigène Voir toutes Patched 1 (PTCH1) Anticorps
- Patched 1 (PTCH1)
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Patched 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
- Top Product
- Discover our top product PTCH1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PTCH1 Blocking Peptide, catalog no. 33R-9121, is also available for use as a blocking control in assays to test for specificity of this PTCH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Patched 1 (PTCH1)
- Autre désignation
- PTCH1 (PTCH1 Produits)
- Synonymes
- anticorps BCNS, anticorps HPE7, anticorps NBCCS, anticorps PTC, anticorps PTC1, anticorps PTCH, anticorps PTCH11, anticorps lep, anticorps ptc1, anticorps ptc2, anticorps Ptch, anticorps Ptch2, anticorps Ptc-1, anticorps XPtc1, anticorps patched, anticorps patched1, anticorps A230106A15Rik, anticorps Ptc, anticorps Ptc1, anticorps mes, anticorps patched 1, anticorps patched 1 L homeolog, anticorps Protein patched homolog 1, anticorps PTCH1, anticorps ptch1, anticorps Ptch1, anticorps ptch1.L, anticorps ptc-1
- Sujet
- PTCH1 is a member of the patched gene family. The protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. It functions as a tumor suppressor. Mutations of its gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- Signalisation Hedgehog, Carbohydrate Homeostasis, Tube Formation
-