Kallikrein 5 anticorps (N-Term)

N° du produit ABIN634928

Détail du produit anti-Kallikrein 5 anticorps

Antigène: Kallikrein 5 (KLK5)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Kallikrein 5 est non-conjugé

Application: Western Blotting (WB)

Specificité: KLK5 antibody was raised against the N terminal of KLK5

Purification: Affinity purified

Immunogène: KLK5 antibody was raised using the N terminal of KLK5 corresponding to a region with amino acids CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLK5 Blocking Peptide, catalog no. 33R-1662, is also available for use as a blocking control in assays to test for specificity of this KLK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Kallikrein 5

Antigène: Kallikrein 5 (KLK5)

Autre désignation: KLK5 (KLK5 Produits)

Synonymes: anticorps KLK-L2, anticorps KLKL2, anticorps SCTE, anticorps 1110030O19Rik, anticorps KAL, anticorps KALA, anticorps Klk1, anticorps Klk5, anticorps RATKALA, anticorps kallikrein related peptidase 5, anticorps kallikrein related-peptidase 5, anticorps kallikrein 5-like, anticorps KLK5, anticorps Klk5, anticorps Klk5l

Sujet: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Système du Complément, Regulation of G-Protein Coupled Receptor Protein Signaling