MMP24 anticorps
-
- Antigène Voir toutes MMP24 Anticorps
- MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MMP24 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW
- Top Product
- Discover our top product MMP24 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MMP24 Blocking Peptide, catalog no. 33R-3551, is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))
- Autre désignation
- MMP24 (MMP24 Produits)
- Synonymes
- anticorps MMP-24, anticorps MMP25, anticorps MT-MMP 5, anticorps MT-MMP5, anticorps MT5-MMP, anticorps MT5MMP, anticorps MTMMP5, anticorps AU040325, anticorps Mt5-mmp, anticorps si:ch211-239j9.5, anticorps MMP24, anticorps mt3-mmp, anticorps matrix metallopeptidase 24, anticorps matrix metallopeptidase 16 S homeolog, anticorps MMP24, anticorps Mmp24, anticorps mmp24, anticorps mmp16.S
- Sujet
- This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.
- Poids moléculaire
- 57 kDa (MW of target protein)
-