MMP23B anticorps (N-Term)

N° du produit ABIN634931

Détail du produit anti-MMP23B anticorps

Antigène: MMP23B (Matrix Metallopeptidase 23B (MMP23B))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP23B est non-conjugé

Application: Western Blotting (WB)

Specificité: MMP23 B antibody was raised against the N terminal of MMP23

Purification: Affinity purified

Immunogène: MMP23 B antibody was raised using the N terminal of MMP23 corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP23B Blocking Peptide, catalog no. 33R-4060, is also available for use as a blocking control in assays to test for specificity of this MMP23B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP23B

Antigène: MMP23B (Matrix Metallopeptidase 23B (MMP23B))

Autre désignation: MMP23B (MMP23B Produits)

Sujet: MMP23B is a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.

Poids moléculaire: 36 kDa (MW of target protein)