SPATA9 anticorps (N-Term)

N° du produit ABIN634932

Détail du produit anti-SPATA9 anticorps

Antigène: SPATA9 (Spermatogenesis Associated 9 (SPATA9))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPATA9 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPATA9 antibody was raised against the N terminal of SPATA9

Purification: Affinity purified

Immunogène: SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPATA9 Blocking Peptide, catalog no. 33R-7156, is also available for use as a blocking control in assays to test for specificity of this SPATA9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPATA9

Antigène: SPATA9 (Spermatogenesis Associated 9 (SPATA9))

Autre désignation: SPATA9 (SPATA9 Produits)

Synonymes: anticorps SPATA9, anticorps NYD-SP16, anticorps 1700030K01Rik, anticorps 4930599C08Rik, anticorps A930023H06Rik, anticorps spermatogenesis associated 9, anticorps SPATA9, anticorps Spata9

Sujet: SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.

Poids moléculaire: 29 kDa (MW of target protein)