ATP2B3 anticorps (N-Term)
-
- Antigène Voir toutes ATP2B3 Anticorps
- ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATP2B3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ATP2 B3 antibody was raised against the N terminal of ATP2 3
- Purification
- Affinity purified
- Immunogène
- ATP2 B3 antibody was raised using the N terminal of ATP2 3 corresponding to a region with amino acids AEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQ
- Top Product
- Discover our top product ATP2B3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATP2B3 Blocking Peptide, catalog no. 33R-1117, is also available for use as a blocking control in assays to test for specificity of this ATP2B3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATP2B3 (ATPase, Ca++ Transporting, Plasma Membrane 3 (ATP2B3))
- Autre désignation
- ATP2B3 (ATP2B3 Produits)
- Synonymes
- anticorps PMCA3, anticorps PMCA3a, anticorps SCAX1, anticorps atp2b3, anticorps pmca3a, anticorps zgc:92885, anticorps 6430519O13Rik, anticorps Pmca3, anticorps ATPase plasma membrane Ca2+ transporting 3, anticorps ATPase, Ca++ transporting, plasma membrane 3a, anticorps ATPase, Ca++ transporting, plasma membrane 3, anticorps plasma membrane calcium-transporting ATPase 2, anticorps ATP2B3, anticorps atp2b3a, anticorps Atp2b3, anticorps atp2b3, anticorps LOC100639471
- Sujet
- ATP2B3 gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. ATP2B3 is the plasma membrane calcium ATPase isoform 3.
- Poids moléculaire
- 134 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-