Derlin-3 anticorps (C-Term)

N° du produit ABIN634939

Détail du produit anti-Derlin-3 anticorps

Antigène: Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Derlin-3 est non-conjugé

Application: Western Blotting (WB)

Specificité: DERL3 antibody was raised against the C terminal of DERL3

Purification: Affinity purified

Immunogène: DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DERL3 Blocking Peptide, catalog no. 33R-10295, is also available for use as a blocking control in assays to test for specificity of this DERL3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DERL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Derlin-3

Antigène: Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))

Autre désignation: DERL3 (DERL3 Produits)

Sujet: DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling