POMT2 anticorps (Middle Region)

N° du produit ABIN634940

Détail du produit anti-POMT2 anticorps

Antigène: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POMT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: POMT2 antibody was raised against the middle region of POMT2

Purification: Affinity purified

Immunogène: POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POMT2 Blocking Peptide, catalog no. 33R-7995, is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POMT2

Antigène: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Autre désignation: POMT2 (POMT2 Produits)

Synonymes: anticorps CG12311, anticorps DPOMT2, anticorps DmPOMT2, anticorps Dmel\\CG12311, anticorps EG:34F3.7, anticorps POMT2, anticorps Pomt2, anticorps dPOMT2, anticorps im:7153045, anticorps zPOMT2, anticorps zgc:158749, anticorps LGMD2N, anticorps MDDGA2, anticorps MDDGB2, anticorps MDDGC2, anticorps A830009D15Rik, anticorps AW046274, anticorps twisted, anticorps protein O-mannosyltransferase 2, anticorps protein-O-mannosyltransferase 2, anticorps tw, anticorps POMT2, anticorps pomt2, anticorps Pomt2

Sujet: POMT2 encodes an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S.cerevisiae.

Poids moléculaire: 84 kDa (MW of target protein)