TMEM30A anticorps (N-Term)

N° du produit ABIN634944

Détail du produit anti-TMEM30A anticorps

Antigène: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Épitope: N-Term

Reactivité: Souris, Rat, Humain, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM30A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TMEM30 A antibody was raised against the N terminal of TMEM30

Purification: Affinity purified

Immunogène: TMEM30 A antibody was raised using the N terminal of TMEM30 corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM30A Blocking Peptide, catalog no. 33R-3094, is also available for use as a blocking control in assays to test for specificity of this TMEM30A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM30A

Antigène: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Autre désignation: TMEM30A (TMEM30A Produits)

Synonymes: anticorps tmem30a, anticorps wu:fj66b08, anticorps zgc:91877, anticorps fi23a10, anticorps wu:fb15c10, anticorps wu:fi23a10, anticorps zgc:55379, anticorps zgc:77655, anticorps cg9947, anticorps MGC53259, anticorps MGC75889, anticorps CDC50A, anticorps DKFZp459A091, anticorps DKFZp459D097, anticorps DKFZp459B0431, anticorps C6orf67, anticorps 2010200I23Rik, anticorps AW540225, anticorps Cdc50a, anticorps D9Wsu20e, anticorps transmembrane protein 30Aa, anticorps transmembrane protein 30A, anticorps transmembrane protein 30Ab, anticorps transmembrane protein 30A L homeolog, anticorps tmem30aa, anticorps TMEM30A, anticorps tmem30ab, anticorps tmem30a.L, anticorps tmem30a, anticorps LOAG_03933, anticorps Tmem30a

Sujet: The function of TMEM30A protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)