MFF anticorps (C-Term)

N° du produit ABIN634945

Détail du produit anti-MFF anticorps

Antigène: MFF (Mitochondrial Fission Factor (MFF))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFF est non-conjugé

Application: Western Blotting (WB)

Specificité: C2 ORF33 antibody was raised against the C terminal Of C2 rf33

Purification: Affinity purified

Immunogène: C2 ORF33 antibody was raised using the C terminal Of C2 rf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C2ORF33 Blocking Peptide, catalog no. 33R-9870, is also available for use as a blocking control in assays to test for specificity of this C2ORF33 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFF

Antigène: MFF (Mitochondrial Fission Factor (MFF))

Autre désignation: C2ORF33 (MFF Produits)

Synonymes: anticorps zgc:66022, anticorps mff, anticorps gl004, anticorps MGC79121, anticorps MGC80099, anticorps C2orf33, anticorps GL004, anticorps C2H2orf33, anticorps 5230400G24Rik, anticorps AI314724, anticorps RGD1310230, anticorps mitochondrial fission factor, anticorps mitochondrial fission factor L homeolog, anticorps mitochondrial fission factor S homeolog, anticorps mff, anticorps mff.L, anticorps mff.S, anticorps MFF, anticorps Mff

Sujet: C2orf33 plays a role in mitochondrial and peroxisomal fission.

Poids moléculaire: 38 kDa (MW of target protein)