POPDC3 anticorps (C-Term)

N° du produit ABIN634947

Détail du produit anti-POPDC3 anticorps

Antigène: POPDC3 (Popeye Domain Containing 3 (POPDC3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp POPDC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: POPDC3 antibody was raised against the C terminal of POPDC3

Purification: Affinity purified

Immunogène: POPDC3 antibody was raised using the C terminal of POPDC3 corresponding to a region with amino acids YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

POPDC3 Blocking Peptide, catalog no. 33R-10174, is also available for use as a blocking control in assays to test for specificity of this POPDC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POPDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur POPDC3

Antigène: POPDC3 (Popeye Domain Containing 3 (POPDC3))

Autre désignation: POPDC3 (POPDC3 Produits)

Synonymes: anticorps pop3, anticorps POP1, anticorps POP3, anticorps RP11-99L11.2, anticorps bA355M14.1, anticorps AA682104, anticorps Pop3, anticorps popeye domain containing 3, anticorps POPDC3, anticorps popdc3, anticorps Popdc3

Sujet: POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.

Poids moléculaire: 34 kDa (MW of target protein)