PAQR6 anticorps (N-Term)
-
- Antigène Tous les produits PAQR6
- PAQR6 (Progestin and AdipoQ Receptor Family Member VI (PAQR6))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAQR6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PAQR6 antibody was raised against the N terminal of PAQR6
- Purification
- Affinity purified
- Immunogène
- PAQR6 antibody was raised using the N terminal of PAQR6 corresponding to a region with amino acids PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PAQR6 Blocking Peptide, catalog no. 33R-7117, is also available for use as a blocking control in assays to test for specificity of this PAQR6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAQR6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAQR6 (Progestin and AdipoQ Receptor Family Member VI (PAQR6))
- Autre désignation
- PAQR6 (PAQR6 Produits)
- Synonymes
- anticorps MGC115032, anticorps paqr6, anticorps 1500001B10Rik, anticorps putative progestin and adipoq receptor family member VI, anticorps progestin and adipoQ receptor family member VI L homeolog, anticorps progestin and adipoQ receptor family member VI, anticorps progestin and adipoQ receptor family member VI S homeolog, anticorps progestin and adipoQ receptor family member 6, anticorps Smp_086190, anticorps paqr6.L, anticorps paqr6, anticorps paqr6.S, anticorps PAQR6, anticorps Paqr6
- Sujet
- This protein mediates receptor activity.
- Poids moléculaire
- 39 kDa (MW of target protein)
-