TMEM163 anticorps (Middle Region)

N° du produit ABIN634949

Détail du produit anti-TMEM163 anticorps

Antigène: TMEM163 (Transmembrane Protein 163 (TMEM163))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM163 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM163 antibody was raised against the middle region of TMEM163

Purification: Affinity purified

Immunogène: TMEM163 antibody was raised using the middle region of TMEM163 corresponding to a region with amino acids AAVHSAHREYIACVILGVIFLLSSICIVVKAIHDLSTRLLPEVDDFLFSV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM163 Blocking Peptide, catalog no. 33R-1058, is also available for use as a blocking control in assays to test for specificity of this TMEM163 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM163 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM163

Antigène: TMEM163 (Transmembrane Protein 163 (TMEM163))

Autre désignation: TMEM163 (TMEM163 Produits)

Synonymes: anticorps si:dkey-57b6.2, anticorps DC29, anticorps SV31, anticorps 2610024A01Rik, anticorps RGD1306212, anticorps Sv31, anticorps transmembrane protein 163a, anticorps Transmembrane protein 163, anticorps transmembrane protein 163, anticorps transmembrane protein 163 L homeolog, anticorps tmem163a, anticorps tm163, anticorps TMEM163, anticorps Tmem163, anticorps tmem163.L

Sujet: The function of TMEM163 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 31 kDa (MW of target protein)