OMG anticorps (N-Term)

N° du produit ABIN634957

Détail du produit anti-OMG anticorps

Antigène: OMG (Oligodendrocyte Myelin Glycoprotein (OMG))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OMG est non-conjugé

Application: Western Blotting (WB)

Specificité: OMG antibody was raised against the N terminal of OMG

Purification: Affinity purified

Immunogène: OMG antibody was raised using the N terminal of OMG corresponding to a region with amino acids ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OMG Blocking Peptide, catalog no. 33R-1403, is also available for use as a blocking control in assays to test for specificity of this OMG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OMG

Antigène: OMG (Oligodendrocyte Myelin Glycoprotein (OMG))

Autre désignation: OMG (OMG Produits)

Synonymes: anticorps OMGP, anticorps omgp, anticorps MGC107958, anticorps OMG, anticorps DKFZp459F1351, anticorps oligodendrocyte myelin glycoprotein, anticorps myelin oligodendrocyte glycoprotein, anticorps oligodendrocyte-myelin glycoprotein, anticorps OMG, anticorps MOG, anticorps Omg, anticorps omg

Sujet: OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, Regulation of Cell Size