GTPase, IMAP Family Member 1 (GIMAP1) (N-Term) anticorps

N° du produit ABIN634959

Détail du produit

Antigène: GTPase, IMAP Family Member 1 (GIMAP1)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: GIMAP1 antibody was raised against the N terminal of GIMAP1

Purification: Affinity purified

Immunogène: GIMAP1 antibody was raised using the N terminal of GIMAP1 corresponding to a region with amino acids MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GIMAP1 Blocking Peptide, catalog no. 33R-6034, is also available for use as a blocking control in assays to test for specificity of this GIMAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIMAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: GTPase, IMAP Family Member 1 (GIMAP1)

Autre désignation: GIMAP1 (GIMAP1 Produits)

Synonymes: anticorps HIMAP1, anticorps IMAP1, anticorps IMAP38, anticorps IAP38, anticorps Imap38, anticorps imap, anticorps Ian2, anticorps GTPase, IMAP family member 1, anticorps GIMAP1, anticorps Gimap1

Sujet: GIMAP1 belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.

Poids moléculaire: 34 kDa (MW of target protein)