BTNL8 anticorps (N-Term)

N° du produit ABIN634963

Détail du produit anti-BTNL8 anticorps

Antigène: BTNL8 (Butyrophilin-Like 8 (BTNL8))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BTNL8 est non-conjugé

Application: Western Blotting (WB)

Specificité: BTNL8 antibody was raised against the N terminal of BTNL8

Purification: Affinity purified

Immunogène: BTNL8 antibody was raised using the N terminal of BTNL8 corresponding to a region with amino acids MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BTNL8 Blocking Peptide, catalog no. 33R-5692, is also available for use as a blocking control in assays to test for specificity of this BTNL8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BTNL8

Antigène: BTNL8 (Butyrophilin-Like 8 (BTNL8))

Autre désignation: BTNL8 (BTNL8 Produits)

Synonymes: anticorps Btnl8, anticorps BTNL8, anticorps butyrophilin like 8, anticorps butyrophilin-like 8, anticorps BTNL8, anticorps Btnl8, anticorps btnl8

Sujet: BTNL8 is a single-pass type I membrane protein. It belongs to the immunoglobulin superfamily, BTN/MOG family. BTNL8 contains 1 B30.2/SPRY domain and 1 Ig-like V-type domain. The exact function of BTNL8 remains unknown.

Poids moléculaire: 57 kDa (MW of target protein)