MARVELD3 anticorps (Middle Region)
-
- Antigène Voir toutes MARVELD3 Anticorps
- MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MARVELD3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- MARVELD3 antibody was raised against the middle region of MARVELD3
- Purification
- Affinity purified
- Immunogène
- MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MARVELD3 Blocking Peptide, catalog no. 33R-8948, is also available for use as a blocking control in assays to test for specificity of this MARVELD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))
- Autre désignation
- MARVELD3 (MARVELD3 Produits)
- Sujet
- MARVELD3 is involved in membrane apposition and fusion events.
- Poids moléculaire
- 46 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-