Cyclin M2 anticorps (Middle Region)
-
- Antigène Voir toutes Cyclin M2 (CNNM2) Anticorps
- Cyclin M2 (CNNM2)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cyclin M2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Cyclin M2 antibody was raised against the middle region of CNNM2
- Purification
- Affinity purified
- Immunogène
- Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL
- Top Product
- Discover our top product CNNM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Cyclin M2 Blocking Peptide, catalog no. 33R-2471, is also available for use as a blocking control in assays to test for specificity of this Cyclin M2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cyclin M2 (CNNM2)
- Autre désignation
- Cyclin M2 (CNNM2 Produits)
- Synonymes
- anticorps acdp4, anticorps cnnm4, anticorps ACDP2, anticorps AU015877, anticorps AW048635, anticorps Acdp2, anticorps Clp2, anticorps cyclin and CBS domain divalent metal cation transport mediator 2, anticorps metal transporter CNNM2, anticorps cyclin M2, anticorps CNNM2, anticorps cnnm2, anticorps LOC100059801, anticorps Cnnm2
- Sujet
- CNNM2 is a divalent metal cation transporter. CNNM2 mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ > Ba2+ > Cu2+ > Fe2+.
- Poids moléculaire
- 96 kDa (MW of target protein)
-