CDS1 anticorps

N° du produit ABIN634970

Détail du produit anti-CDS1 anticorps

Antigène: CDS1 (CDP-Diacylglycerol Synthase (Phosphatidate Cytidylyltransferase) 1 (CDS1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDS1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CDS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVFGFIAAYVLSKYQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDS1 Blocking Peptide, catalog no. 33R-9876, is also available for use as a blocking control in assays to test for specificity of this CDS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDS1

Antigène: CDS1 (CDP-Diacylglycerol Synthase (Phosphatidate Cytidylyltransferase) 1 (CDS1))

Autre désignation: CDS1 (CDS1 Produits)

Synonymes: anticorps CDS, anticorps 4833409J18Rik, anticorps AI314024, anticorps AW125888, anticorps CDP-diacylglycerol synthase 1, anticorps CDS1, anticorps Cds1

Sujet: Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. CDS1 is an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Inositol Metabolic Process