SLC25A36 anticorps (N-Term)
-
- Antigène Tous les produits SLC25A36
- SLC25A36 (Solute Carrier Family 25, Member 36 (SLC25A36))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A36 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC25 A36 antibody was raised against the N terminal of SLC25 36
- Purification
- Affinity purified
- Immunogène
- SLC25 A36 antibody was raised using the N terminal of SLC25 36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A36 Blocking Peptide, catalog no. 33R-8854, is also available for use as a blocking control in assays to test for specificity of this SLC25A36 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 36 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A36 (Solute Carrier Family 25, Member 36 (SLC25A36))
- Autre désignation
- SLC25A36 (SLC25A36 Produits)
- Synonymes
- anticorps MGC131068, anticorps slc25a36b, anticorps DKFZp459O044, anticorps slc25a36, anticorps slc25a36a, anticorps PNC2, anticorps C330005L02Rik, anticorps solute carrier family 25 member 36, anticorps solute carrier family 25 (pyrimidine nucleotide carrier), member 36 L homeolog, anticorps solute carrier family 25 (pyrimidine nucleotide carrier), member 36 S homeolog, anticorps solute carrier family 25, member 36, anticorps SLC25A36, anticorps slc25a36.L, anticorps slc25a36.S, anticorps Slc25a36
- Sujet
- SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.
- Poids moléculaire
- 34 kDa (MW of target protein)
-