CKLF anticorps (N-Term)

N° du produit ABIN634980

Détail du produit anti-CKLF anticorps

Antigène: CKLF (Chemokine-Like Factor (CKLF))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CKLF est non-conjugé

Application: Western Blotting (WB)

Specificité: CKLF antibody was raised against the N terminal of CKLF

Purification: Affinity purified

Immunogène: CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CKLF Blocking Peptide, catalog no. 33R-5854, is also available for use as a blocking control in assays to test for specificity of this CKLF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKLF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CKLF

Antigène: CKLF (Chemokine-Like Factor (CKLF))

Autre désignation: CKLF (CKLF Produits)

Synonymes: anticorps C32, anticorps CKLF1, anticorps CKLF2, anticorps CKLF3, anticorps CKLF4, anticorps UCK-1, anticorps 1700001C14Rik, anticorps 1810018M11Rik, anticorps CKLF5, anticorps Cklf2, anticorps Cklf6, anticorps HSPC224, anticorps Cklf1, anticorps chemokine like factor, anticorps chemokine-like factor, anticorps CKLF, anticorps Cklf, anticorps LOC100727126, anticorps LOC101103916

Sujet: CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.

Poids moléculaire: 13 kDa (MW of target protein)