SPPL2B anticorps (N-Term)
-
- Antigène Voir toutes SPPL2B Anticorps
- SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPPL2B est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SPPL2 B antibody was raised against the N terminal of SPPL2
- Purification
- Affinity purified
- Immunogène
- SPPL2 B antibody was raised using the N terminal of SPPL2 corresponding to a region with amino acids VARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVAL
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPPL2B Blocking Peptide, catalog no. 33R-9434, is also available for use as a blocking control in assays to test for specificity of this SPPL2B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPPL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPPL2B (Signal Peptide Peptidase-Like 2B (SPPL2B))
- Autre désignation
- SPPL2B (SPPL2B Produits)
- Sujet
- SPPL2B is a member of the GXGD family of aspartic proteases. The GXGD proteases are transmembrane proteins with two conserved catalytic motifs localized within the membrane-spanning regions. This enzyme localizes to endosomes, lysosomes, and the plasma membrane. It cleaves the transmembrane domain of tumor necrosis factor alpha to release the intracellular domain, which triggers cytokine expression in the innate and adaptive immunity pathways.
- Poids moléculaire
- 56 kDa (MW of target protein)
-