ATG9A anticorps
-
- Antigène Voir toutes ATG9A Anticorps
- ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ATG9A est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ATG9 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV
- Top Product
- Discover our top product ATG9A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ATG9A Blocking Peptide, catalog no. 33R-9437, is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))
- Autre désignation
- ATG9A (ATG9A Produits)
- Synonymes
- anticorps ATG9, anticorps ATG9A, anticorps zgc:158700, anticorps APG9L1, anticorps DKFZp459N117, anticorps MGD3208, anticorps mATG9, anticorps AU019532, anticorps Apg9l1, anticorps Atg9, anticorps Atg9l1, anticorps RGD1310450, anticorps autophagy related 9A, anticorps ATG9 autophagy related 9 homolog A (S. cerevisiae), anticorps ATG9A, anticorps atg9a, anticorps Atg9a
- Sujet
- ATG9A belongs to the ATG9 family. It plays a role in autophagy.
- Poids moléculaire
- 94 kDa (MW of target protein)
-