VSIG8 anticorps (N-Term)

N° du produit ABIN634989

Détail du produit anti-VSIG8 anticorps

Antigène: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VSIG8 est non-conjugé

Application: Western Blotting (WB)

Specificité: VSIG8 antibody was raised against the N terminal of VSIG8

Purification: Affinity purified

Immunogène: VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VSIG8 Blocking Peptide, catalog no. 33R-3838, is also available for use as a blocking control in assays to test for specificity of this VSIG8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VSIG8

Antigène: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Autre désignation: VSIG8 (VSIG8 Produits)

Synonymes: anticorps A030011M19, anticorps EG240916, anticorps RGD1562464, anticorps zgc:110326, anticorps V-set and immunoglobulin domain containing 8, anticorps V-set and immunoglobulin domain-containing protein 8, anticorps V-set and immunoglobulin domain containing 8a, anticorps Vsig8, anticorps VSIG8, anticorps LOC100403027, anticorps vsig8a

Sujet: VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.

Poids moléculaire: 44 kDa (MW of target protein)