ALG11 anticorps (C-Term)

N° du produit ABIN634990

Détail du produit anti-ALG11 anticorps

Antigène: ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALG11 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ALG11 antibody was raised against the C terminal of ALG11

Purification: Affinity purified

Immunogène: ALG11 antibody was raised using the C terminal of ALG11 corresponding to a region with amino acids LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALG11 Blocking Peptide, catalog no. 33R-5030, is also available for use as a blocking control in assays to test for specificity of this ALG11 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALG11

Antigène: ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))

Autre désignation: ALG11 (ALG11 Produits)

Synonymes: anticorps UTP14C, anticorps CDG1P, anticorps GT8, anticorps RGD1564725, anticorps AI849156, anticorps AW492253, anticorps B230397C21, anticorps si:dkey-1h24.5, anticorps wu:fj04e04, anticorps asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase, anticorps ALG11, alpha-1,2-mannosyltransferase, anticorps ALG11, alpha-1,2-mannosyltransferase L homeolog, anticorps asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase), anticorps alg11, anticorps ALG11, anticorps alg11.L, anticorps Alg11

Sujet: ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase which is localized to the cytosolic side of the endoplasmic reticulum (ER) and catalyzes the transfer of the fourth and fifth mannose residue from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol resulting in the production of Man5GlcNAc2-PP-dolichol. Mutations in this gene are associated with congenital disorder of glycosylation type Ip (CDGIP).

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome