TMEM138 anticorps (N-Term)

N° du produit ABIN635004

Détail du produit anti-TMEM138 anticorps

Antigène: TMEM138 (Transmembrane Protein 138 (TMEM138))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM138 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM138 antibody was raised against the N terminal of TMEM138

Purification: Affinity purified

Immunogène: TMEM138 antibody was raised using the N terminal of TMEM138 corresponding to a region with amino acids MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM138 Blocking Peptide, catalog no. 33R-6207, is also available for use as a blocking control in assays to test for specificity of this TMEM138 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM138 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM138

Antigène: TMEM138 (Transmembrane Protein 138 (TMEM138))

Autre désignation: TMEM138 (TMEM138 Produits)

Synonymes: anticorps MGC79801, anticorps 1700113I01Rik, anticorps 2900055D14Rik, anticorps transmembrane protein 138, anticorps TMEM138, anticorps tmem138, anticorps Tsp_00664, anticorps Tmem138

Sujet: TMEM138 is a multi-pass membrane protein.It belongs to the TMEM138 family. The function of the TMEM138 protein remains unknown.

Poids moléculaire: 19 kDa (MW of target protein)