TM7SF2 anticorps (N-Term)

N° du produit ABIN635009

Détail du produit anti-TM7SF2 anticorps

Antigène: TM7SF2 (Transmembrane 7 Superfamily Member 2 (TM7SF2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TM7SF2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TM7 SF2 antibody was raised against the N terminal of TM7 F2

Purification: Affinity purified

Immunogène: TM7 SF2 antibody was raised using the N terminal of TM7 F2 corresponding to a region with amino acids LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TM7SF2 Blocking Peptide, catalog no. 33R-4757, is also available for use as a blocking control in assays to test for specificity of this TM7SF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TM7SF2

Antigène: TM7SF2 (Transmembrane 7 Superfamily Member 2 (TM7SF2))

Autre désignation: TM7SF2 (TM7SF2 Produits)

Synonymes: anticorps 3110041O18Rik, anticorps ANG1, anticorps C14SR, anticorps Dhcr14, anticorps DHCR14A, anticorps NET47, anticorps zgc:103611, anticorps tm7sf2, anticorps transmembrane 7 superfamily member 2, anticorps transmembrane 7 superfamily member 2 L homeolog, anticorps TM7SF2, anticorps Tm7sf2, anticorps tm7sf2, anticorps tm7sf2.L

Sujet: TM7SF2 is involved in the conversion of lanosterol to cholesterol.

Poids moléculaire: 46 kDa (MW of target protein)