NBC4 anticorps (Middle Region)
-
- Antigène Voir toutes NBC4 Anticorps
- NBC4 (Electrogenic Sodium Bicarbonate Cotransporter 4 (NBC4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NBC4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLC4 A5 antibody was raised against the middle region of SLC4 5
- Purification
- Affinity purified
- Immunogène
- SLC4 A5 antibody was raised using the middle region of SLC4 5 corresponding to a region with amino acids SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL
- Top Product
- Discover our top product NBC4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC4A5 Blocking Peptide, catalog no. 33R-8521, is also available for use as a blocking control in assays to test for specificity of this SLC4A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NBC4 (Electrogenic Sodium Bicarbonate Cotransporter 4 (NBC4))
- Autre désignation
- SLC4A5 (NBC4 Produits)
- Synonymes
- anticorps NBC4, anticorps solute carrier family 4 member 5, anticorps SLC4A5, anticorps Slc4a5
- Sujet
- This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation.
- Poids moléculaire
- 126 kDa (MW of target protein)
-