SLC16A12 anticorps
-
- Antigène Voir toutes SLC16A12 Anticorps
- SLC16A12 (Solute Carrier Family 16, Member 12 (Monocarboxylic Acid Transporter 12) (SLC16A12))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC16A12 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC16 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVT
- Top Product
- Discover our top product SLC16A12 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC16A12 Blocking Peptide, catalog no. 33R-9979, is also available for use as a blocking control in assays to test for specificity of this SLC16A12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC16A12 (Solute Carrier Family 16, Member 12 (Monocarboxylic Acid Transporter 12) (SLC16A12))
- Autre désignation
- SLC16A12 (SLC16A12 Produits)
- Synonymes
- anticorps CJMG, anticorps MCT12, anticorps 3230401A21, anticorps AW210596, anticorps RGD1311468, anticorps slc16a12, anticorps MGC76256, anticorps im:7140871, anticorps wu:fc44b08, anticorps zgc:110441, anticorps solute carrier family 16 member 12, anticorps solute carrier family 16 (monocarboxylic acid transporters), member 12, anticorps solute carrier family 16, member 12, anticorps solute carrier family 16 member 12 S homeolog, anticorps solute carrier family 16, member 12b, anticorps SLC16A12, anticorps Slc16a12, anticorps slc16a12, anticorps slc16a12.S, anticorps slc16a12b
- Sujet
- As a proton-linked monocarboxylate transporter, SLC16A12 catalyzes the rapid transport across the plasma membrane of many monocarboxylates.
- Poids moléculaire
- 53 kDa (MW of target protein)
-