TMEM30B anticorps (Middle Region)

N° du produit ABIN635017

Détail du produit anti-TMEM30B anticorps

Antigène: TMEM30B (Transmembrane Protein 30B (TMEM30B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM30B est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM30 B antibody was raised against the middle region of TMEM30

Purification: Affinity purified

Immunogène: TMEM30 B antibody was raised using the middle region of TMEM30 corresponding to a region with amino acids VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM30B Blocking Peptide, catalog no. 33R-9922, is also available for use as a blocking control in assays to test for specificity of this TMEM30B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM30B

Antigène: TMEM30B (Transmembrane Protein 30B (TMEM30B))

Autre désignation: TMEM30B (TMEM30B Produits)

Synonymes: anticorps CDC50B, anticorps 9130011B11Rik, anticorps transmembrane protein 30B, anticorps TMEM30B, anticorps Tmem30b

Sujet: TMEM30B belongs to the CDC50/LEM3 family. It is a multi-pass membrane protein. The function of the TMEM30B protein remains unknown.

Poids moléculaire: 39 kDa (MW of target protein)