NCAM2 anticorps (Middle Region)
-
- Antigène Voir toutes NCAM2 Anticorps
- NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NCAM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NCAM2 antibody was raised against the middle region of NCAM2
- Purification
- Affinity purified
- Immunogène
- NCAM2 antibody was raised using the middle region of NCAM2 corresponding to a region with amino acids KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL
- Top Product
- Discover our top product NCAM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NCAM2 Blocking Peptide, catalog no. 33R-4400, is also available for use as a blocking control in assays to test for specificity of this NCAM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NCAM2 (Neural Cell Adhesion Molecule 2 (NCAM2))
- Autre désignation
- NCAM2 (NCAM2 Produits)
- Synonymes
- anticorps NCAM21, anticorps Ncam-2, anticorps Ocam, anticorps RNCAM, anticorps zOCAM, anticorps OCAM-GPI, anticorps NCAM2, anticorps ncam21, anticorps neural cell adhesion molecule 2, anticorps zgc:152904, anticorps NCAM2, anticorps Ncam2, anticorps ncam2, anticorps LOC100471034, anticorps zgc:152904
- Sujet
- The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
- Poids moléculaire
- 91 kDa (MW of target protein)
-