ERGIC3 anticorps (C-Term)

N° du produit ABIN635020

Détail du produit anti-ERGIC3 anticorps

Antigène: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERGIC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: ERGIC3 antibody was raised against the C terminal of ERGIC3

Purification: Affinity purified

Immunogène: ERGIC3 antibody was raised using the C terminal of ERGIC3 corresponding to a region with amino acids LTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ERGIC3 Blocking Peptide, catalog no. 33R-5472, is also available for use as a blocking control in assays to test for specificity of this ERGIC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERGIC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERGIC3

Antigène: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Autre désignation: ERGIC3 (ERGIC3 Produits)

Synonymes: anticorps sdbcag84, anticorps zgc:113959, anticorps zgc:55762, anticorps C20orf47, anticorps CGI-54, anticorps Erv46, anticorps NY-BR-84, anticorps PRO0989, anticorps SDBCAG84, anticorps dJ477O4.2, anticorps 2310015B14Rik, anticorps AV318804, anticorps D2Ucla1, anticorps Sdbcag84, anticorps ERGIC and golgi 3, anticorps ERGIC3, anticorps ergic3, anticorps Ergic3

Sujet: ERGIC3 plays a possible role in transport between endoplasmic reticulum and Golgi.

Poids moléculaire: 43 kDa (MW of target protein)