ELOVL5 anticorps

N° du produit ABIN635023

Détail du produit anti-ELOVL5 anticorps

Antigène: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ELOVL5 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ELOVL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ELOVL5 Blocking Peptide, catalog no. 33R-2451, is also available for use as a blocking control in assays to test for specificity of this ELOVL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ELOVL5

Antigène: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Autre désignation: ELOVL5 (ELOVL5 Produits)

Synonymes: anticorps zgc:63549, anticorps elovl2, anticorps 1110059L23Rik, anticorps AI747313, anticorps AU043003, anticorps HELO1, anticorps dJ483K16.1, anticorps rELO1, anticorps ELOVL fatty acid elongase 5, anticorps ELOVL family member 5, elongation of long chain fatty acids (yeast), anticorps ELOVL fatty acid elongase 5 S homeolog, anticorps elovl5, anticorps ELOVL5, anticorps Elovl5, anticorps elovl5.S

Sujet: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.

Poids moléculaire: 35 kDa (MW of target protein)