MARCO anticorps (N-Term)

N° du produit ABIN635028

Détail du produit anti-MARCO anticorps

Antigène: MARCO (Macrophage Receptor with Collagenous Structure (MARCO))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MARCO est non-conjugé

Application: Western Blotting (WB)

Specificité: MARCO antibody was raised against the N terminal of MARCO

Purification: Affinity purified

Immunogène: MARCO antibody was raised using the N terminal of MARCO corresponding to a region with amino acids QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MARCO Blocking Peptide, catalog no. 33R-7477, is also available for use as a blocking control in assays to test for specificity of this MARCO antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARCO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MARCO

Antigène: MARCO (Macrophage Receptor with Collagenous Structure (MARCO))

Autre désignation: MARCO (MARCO Produits)

Synonymes: anticorps AI323439, anticorps Ly112, anticorps Scara2, anticorps SCARA2, anticorps macrophage receptor with collagenous structure, anticorps MARCO, anticorps Marco

Sujet: The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Activation of Innate immune Response