ACSL1 anticorps (N-Term)

N° du produit ABIN635029

Détail du produit anti-ACSL1 anticorps

Antigène: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACSL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ACSL1 antibody was raised against the N terminal of ACSL1

Purification: Affinity purified

Immunogène: ACSL1 antibody was raised using the N terminal of ACSL1 corresponding to a region with amino acids ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACSL1 Blocking Peptide, catalog no. 33R-1349, is also available for use as a blocking control in assays to test for specificity of this ACSL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACSL1

Antigène: ACSL1 (Acsl1) (Acyl-CoA Synthetase Long-Chain Family Member 1 (Acsl1))

Autre désignation: ACSL1 (Acsl1 Produits)

Synonymes: anticorps ACS1, anticorps FACL1, anticorps FACL2, anticorps LACS, anticorps LACS1, anticorps LACS2, anticorps Acas, anticorps Acas1, anticorps Acs, anticorps FACS, anticorps Facl2, anticorps ACS, anticorps COAA, anticorps zgc:110081, anticorps CER8, anticorps ECERIFERUM 8, anticorps LONG-CHAIN ACYL-COA SYNTHASE 1, anticorps T8I13.8, anticorps F13F21.14, anticorps F13F21_14, anticorps LATERAL ROOT DEVELOPMENT 2, anticorps LRD2, anticorps long-chain acyl-CoA synthetase 2, anticorps acyl-CoA synthetase long chain family member 1, anticorps acyl-CoA synthetase long-chain family member 1, anticorps acyl-CoA synthetase long chain family member 1a, anticorps AMP-dependent synthetase and ligase family protein, anticorps long-chain acyl-CoA synthetase 2, anticorps ACSL1, anticorps Acsl1, anticorps acsl1a, anticorps LACS1, anticorps LACS2

Sujet: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha