OLFML2B anticorps (N-Term)

N° du produit ABIN635031

Détail du produit anti-OLFML2B anticorps

Antigène: OLFML2B (Olfactomedin-Like 2B (OLFML2B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OLFML2B est non-conjugé

Application: Western Blotting (WB)

Specificité: OLFML2 B antibody was raised against the N terminal of OLFML2

Purification: Affinity purified

Immunogène: OLFML2 B antibody was raised using the N terminal of OLFML2 corresponding to a region with amino acids EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OLFML2B Blocking Peptide, catalog no. 33R-2397, is also available for use as a blocking control in assays to test for specificity of this OLFML2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OLFML0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OLFML2B

Antigène: OLFML2B (Olfactomedin-Like 2B (OLFML2B))

Autre désignation: OLFML2B (OLFML2B Produits)

Synonymes: anticorps RP11-227F8.1, anticorps 1110018N05Rik, anticorps 4832415H08Rik, anticorps AI467542, anticorps olfactomedin like 2B, anticorps olfactomedin-like 2B, anticorps olfactomedin-like 2Bb, anticorps OLFML2B, anticorps Olfml2b, anticorps olfml2bb

Sujet: The function of OLFML2B protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 84 kDa (MW of target protein)