MAVS anticorps (C-Term)
-
- Antigène Voir toutes MAVS Anticorps
- MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAVS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- VISA antibody was raised against the C terminal of VISA
- Purification
- Affinity purified
- Immunogène
- VISA antibody was raised using the C terminal of VISA corresponding to a region with amino acids VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ
- Top Product
- Discover our top product MAVS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
VISA Blocking Peptide, catalog no. 33R-9412, is also available for use as a blocking control in assays to test for specificity of this VISA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VISA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAVS (Mitochondrial Antiviral Signaling Protein (MAVS))
- Autre désignation
- VISA (MAVS Produits)
- Synonymes
- anticorps CARDIF, anticorps IPS-1, anticorps IPS1, anticorps VISA, anticorps D430028G21Rik, anticorps Visa, anticorps cardif, anticorps wu:fj20d04, anticorps zgc:158392, anticorps mitochondrial antiviral signaling protein, anticorps MAVS, anticorps Mavs, anticorps mavs
- Sujet
- Double-stranded RNA viruses are recognised in a cell type-dependent manner by the transmembrane receptor TLR3 or by the cytoplasmic RNA helicases MDA5 and RIGI (ROBO3). These interactions initiate signaling pathways that differ in their initial steps but converge in the activation of the protein kinases IKKA (CHUK) and IKKB (IKBKB), which activate NFKB, or TBK1 and IKKE (IKBKE), which activate IRF3. Activated IRF3 and NFKB induce transcription of IFNB (IFNB1). For the TLR3 pathway, the intermediary molecule before the pathways converge is the cytoplasmic protein TRIF (TICAM1). For RIGI, the intermediary protein is mitochondria-bound VISA.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Inositol Metabolic Process, Hepatitis C
-