SLC25A28 anticorps (Middle Region)

N° du produit ABIN635048

Détail du produit anti-SLC25A28 anticorps

Antigène: SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A28 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC25 A28 antibody was raised against the middle region of SLC25 28

Purification: Affinity purified

Immunogène: SLC25 A28 antibody was raised using the middle region of SLC25 28 corresponding to a region with amino acids VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A28 Blocking Peptide, catalog no. 33R-9911, is also available for use as a blocking control in assays to test for specificity of this SLC25A28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A28

Antigène: SLC25A28 (Solute Carrier Family 25, Member 28 (SLC25A28))

Autre désignation: SLC25A28 (SLC25A28 Produits)

Synonymes: anticorps MFRN2, anticorps MRS3/4, anticorps MRS4L, anticorps 2210403D18Rik, anticorps Mfrn2, anticorps Mrs3/4, anticorps mfrn2, anticorps wu:fc48b02, anticorps wu:fc66h02, anticorps zgc:64212, anticorps mrs3/4, anticorps mrs4l, anticorps npd016, anticorps slc25a28-a, anticorps slc25a28-b, anticorps slc25a28, anticorps solute carrier family 25 member 28, anticorps mitoferrin-2-like, anticorps solute carrier family 25, member 28, anticorps solute carrier family 25 (mitochondrial iron transporter), member 28, anticorps solute carrier family 25 member 28 L homeolog, anticorps solute carrier family 25 member 28 S homeolog, anticorps SLC25A28, anticorps LOC100226611, anticorps Slc25a28, anticorps slc25a28, anticorps slc25a28.L, anticorps slc25a28.S

Sujet: SLC25A28 is a mitochondrial iron transporter that mediates iron uptake. It is probably required for heme synthesis of hemoproteins and Fe-S cluster assembly in non-erythroid cells. The iron delivered into the mitochondria, presumably as Fe(2+), is then probably delivered to ferrochelatase to catalyze Fe(2+) incorporation into protoprophyrin IX to make heme.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis