COX10 anticorps (Middle Region)
-
- Antigène Voir toutes COX10 Anticorps
- COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp COX10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- COX10 antibody was raised against the middle region of COX10
- Purification
- Affinity purified
- Immunogène
- COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids DSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVAILTLGVNPLTGALGL
- Top Product
- Discover our top product COX10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
COX10 Blocking Peptide, catalog no. 33R-2170, is also available for use as a blocking control in assays to test for specificity of this COX10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- COX10 (Cytochrome C Oxidase Assembly Homolog 10 (COX10))
- Autre désignation
- COX10 (COX10 Produits)
- Synonymes
- anticorps 2410004F01Rik, anticorps AU042636, anticorps im:7145568, anticorps im:7157205, anticorps wu:fb18a03, anticorps F4I1.50, anticorps F4I1_50, anticorps cytochrome c oxidase 10, anticorps Cox10, anticorps cytochrome c oxidase assembly protein 10, anticorps COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor, anticorps COX10 heme A:farnesyltransferase cytochrome c oxidase assembly factor L homeolog, anticorps COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor, anticorps cytochrome c oxidase 10, anticorps protoheme IX farnesyltransferase, mitochondrial, anticorps Cox10, anticorps cox10, anticorps cox10.L, anticorps COX10, anticorps LOC100732273
- Sujet
- Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. COX10 is a heme A farnesyltransferase.
- Poids moléculaire
- 49 kDa (MW of target protein)
-