PTGER3 anticorps
-
- Antigène Voir toutes PTGER3 Anticorps
- PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PTGER3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILDPWVYLLLRKILLRKFCQIRYHTNNYASSSTSLPCQCSSTLMWSDHLE
- Top Product
- Discover our top product PTGER3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PTGER3 Blocking Peptide, catalog no. 33R-4041, is also available for use as a blocking control in assays to test for specificity of this PTGER3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGER3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))
- Autre désignation
- PTGER3 (PTGER3 Produits)
- Synonymes
- anticorps PTGER3, anticorps EP3, anticorps EP3-I, anticorps EP3-II, anticorps EP3-III, anticorps EP3-IV, anticorps EP3e, anticorps PGE2-R, anticorps PTGEREP3, anticorps Rep3, anticorps rEP3a, anticorps rEP3b, anticorps Pgerep3, anticorps Ptgerep3, anticorps prostaglandin E receptor 3, anticorps prostaglandin E receptor 3 L homeolog, anticorps prostaglandin E receptor 3 (subtype EP3), anticorps PTGER3, anticorps ptger3.L, anticorps Ptger3
- Sujet
- PTGER3 is the receptor for prostaglandin E2 (PGE2), the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.
- Poids moléculaire
- 43 kDa (MW of target protein)
-