CEND1 anticorps (N-Term)

N° du produit ABIN635055

Détail du produit anti-CEND1 anticorps

Antigène: CEND1 (Cell Cycle Exit and Neuronal Differentiation 1 (CEND1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CEND1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CEND1 antibody was raised against the N terminal of CEND1

Purification: Affinity purified

Immunogène: CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CEND1 Blocking Peptide, catalog no. 33R-5964, is also available for use as a blocking control in assays to test for specificity of this CEND1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CEND1

Antigène: CEND1 (Cell Cycle Exit and Neuronal Differentiation 1 (CEND1))

Autre désignation: CEND1 (CEND1 Produits)

Synonymes: anticorps BM88, anticorps 1500001H12Rik, anticorps AI415214, anticorps C38, anticorps RGD1309401, anticorps cell cycle exit and neuronal differentiation 1, anticorps CEND1, anticorps Cend1

Sujet: CEND1 is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.

Poids moléculaire: 15 kDa (MW of target protein)