NHEDC2 anticorps (C-Term)

N° du produit ABIN635063

Détail du produit anti-NHEDC2 anticorps

Antigène: NHEDC2 (Na+/H+ Exchanger Domain Containing 2 (NHEDC2))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NHEDC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NHEDC2 antibody was raised against the C terminal of NHEDC2

Purification: Affinity purified

Immunogène: NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NHEDC2 Blocking Peptide, catalog no. 33R-3957, is also available for use as a blocking control in assays to test for specificity of this NHEDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NHEDC2

Antigène: NHEDC2 (Na+/H+ Exchanger Domain Containing 2 (NHEDC2))

Autre désignation: NHEDC2 (NHEDC2 Produits)

Synonymes: anticorps NHA2, anticorps NHE10, anticorps NHEDC2, anticorps C80638, anticorps Nhedc2, anticorps nha-oc, anticorps nhaoc, anticorps solute carrier family 9 member B2, anticorps solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2, anticorps SLC9B2, anticorps Slc9b2

Sujet: Sodium hydrogen antiporters, such as NHEDC2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Proton Transport