SLC25A21 anticorps

N° du produit ABIN635065

Détail du produit anti-SLC25A21 anticorps

Antigène: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A21 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SLC25 A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A21 Blocking Peptide, catalog no. 33R-3137, is also available for use as a blocking control in assays to test for specificity of this SLC25A21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A21

Antigène: SLC25A21 (Slc25a21) (Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21))

Autre désignation: SLC25A21 (Slc25a21 Produits)

Synonymes: anticorps zgc:153387, anticorps ODC, anticorps ODC1, anticorps Odc1, anticorps 9930033G19Rik, anticorps A630030I10, anticorps BB158148, anticorps solute carrier family 25 (mitochondrial oxoadipate carrier), member 21, anticorps solute carrier family 25 (mitochondrial oxoadipate carrier), member 21 L homeolog, anticorps solute carrier family 25 member 21, anticorps solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21, anticorps slc25a21, anticorps slc25a21.L, anticorps SLC25A21, anticorps Slc25a21

Sujet: SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome