LINGO4 anticorps (Middle Region)
-
- Antigène Voir toutes LINGO4 Anticorps
- LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LINGO4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LINGO4 antibody was raised against the middle region of LINGO4
- Purification
- Affinity purified
- Immunogène
- LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT
- Top Product
- Discover our top product LINGO4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LINGO4 Blocking Peptide, catalog no. 33R-9169, is also available for use as a blocking control in assays to test for specificity of this LINGO4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LINGO4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))
- Autre désignation
- LINGO4 (LINGO4 Produits)
- Sujet
- The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 64 kDa (MW of target protein)
-