SLC25A39 anticorps (C-Term)

N° du produit ABIN635082

Détail du produit anti-SLC25A39 anticorps

Antigène: SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))

Épitope: C-Term

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A39 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SLC25 A39 antibody was raised against the C terminal of SLC25 39

Purification: Affinity purified

Immunogène: SLC25 A39 antibody was raised using the C terminal of SLC25 39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A39 Blocking Peptide, catalog no. 33R-8252, is also available for use as a blocking control in assays to test for specificity of this SLC25A39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A39

Antigène: SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))

Autre désignation: SLC25A39 (SLC25A39 Produits)

Synonymes: anticorps SLC25A39, anticorps zgc:63736, anticorps CGI69, anticorps 3010027G13Rik, anticorps D11Ertd333e, anticorps RGD1306193, anticorps solute carrier family 25 member 39, anticorps solute carrier family 25, member 39, anticorps solute carrier family 25 member 39 L homeolog, anticorps slc25a39, anticorps SLC25A39, anticorps slc25a39.L, anticorps Slc25a39

Sujet: SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.

Poids moléculaire: 39 kDa (MW of target protein)