SLC39A8 anticorps
-
- Antigène Voir toutes SLC39A8 Anticorps
- SLC39A8 (Solute Carrier Family 39 (Zinc Transporter), Member 8 (SLC39A8))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC39A8 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC39 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS
- Top Product
- Discover our top product SLC39A8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC39A8 Blocking Peptide, catalog no. 33R-7635, is also available for use as a blocking control in assays to test for specificity of this SLC39A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC39A8 (Solute Carrier Family 39 (Zinc Transporter), Member 8 (SLC39A8))
- Autre désignation
- SLC39A8 (SLC39A8 Produits)
- Synonymes
- anticorps 4933419D20Rik, anticorps AA986696, anticorps BIGM103, anticorps Zip8, anticorps LZT-Hs6, anticorps ZIP8, anticorps solute carrier family 39 (metal ion transporter), member 8, anticorps solute carrier family 39 member 8, anticorps Slc39a8, anticorps SLC39A8
- Sujet
- This gene encodes a member of the SLC39 family of solute-carrier genes, which show structural characteristics of zinc transporters. The encoded protein is glycosylated and found in the plasma membrane and mitochondria, and functions in the cellular import
- Poids moléculaire
- 50 kDa (MW of target protein)
-