SLC25A22 anticorps
-
- Antigène Voir toutes SLC25A22 Anticorps
- SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC25A22 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC25 A22 antibody was raised using a synthetic peptide corresponding to a region with amino acids VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
- Top Product
- Discover our top product SLC25A22 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC25A22 Blocking Peptide, catalog no. 33R-9708, is also available for use as a blocking control in assays to test for specificity of this SLC25A22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC25A22 (Solute Carrier Family 25 (Mitochondrial Carrier: Glutamate), Member 22 (SLC25A22))
- Autre désignation
- SLC25A22 (SLC25A22 Produits)
- Synonymes
- anticorps 1300006L01Rik, anticorps AI060884, anticorps Gc1, anticorps GC1, anticorps RGD1307826, anticorps EIEE3, anticorps NET44, anticorps solute carrier family 25 (mitochondrial carrier, glutamate), member 22, anticorps solute carrier family 25 member 22, anticorps Slc25a22, anticorps SLC25A22
- Sujet
- The SLC25 family is mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane. SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18.
- Poids moléculaire
- 34 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-